PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000296109
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 667aa    MW: 74616.6 Da    PI: 8.2059
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000296109genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.14.6e-14356403148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W++eEde+l  +    G g+W+ +ar  g+ R++k+c++rw +yl
    MDP0000296109 356 KGLWSPEEDEKLMXYMLTNGQGCWSDVARNAGLQRCGKSCRLRWINYL 403
                      678*******************************************97 PP

2Myb_DNA-binding48.81.6e-15409452146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+++ +  lG++ W+ Ia++++ gRt++++k++w++
    MDP0000296109 409 RGAFSPQEEELIIHFHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 452
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
HamapMF_0141616.76766245IPR000711ATPase, OSCP/delta subunit
Gene3DG3DSA:1.10.520.201.5E-2469172IPR026015F1F0 ATP synthase OSCP/delta subunit, N-terminal domain
PRINTSPR001252.7E-207089IPR000711ATPase, OSCP/delta subunit
SuperFamilySSF479287.72E-2171172IPR026015F1F0 ATP synthase OSCP/delta subunit, N-terminal domain
PfamPF002136.7E-4372243IPR000711ATPase, OSCP/delta subunit
TIGRFAMsTIGR011451.3E-2973243IPR000711ATPase, OSCP/delta subunit
PRINTSPR001252.7E-20140151IPR000711ATPase, OSCP/delta subunit
PRINTSPR001252.7E-20151165IPR000711ATPase, OSCP/delta subunit
PRINTSPR001252.7E-20203218IPR000711ATPase, OSCP/delta subunit
PRINTSPR001252.7E-20218236IPR000711ATPase, OSCP/delta subunit
PROSITE profilePS5129416.27351403IPR017930Myb domain
SuperFamilySSF466892.97E-27354450IPR009057Homeodomain-like
SMARTSM007173.9E-10355405IPR001005SANT/Myb domain
PfamPF002491.1E-12356403IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-22357410IPR009057Homeodomain-like
CDDcd001672.40E-8359403No hitNo description
PROSITE profilePS5129425.144404458IPR017930Myb domain
SMARTSM007172.4E-15408456IPR001005SANT/Myb domain
PfamPF002492.7E-14409452IPR001005SANT/Myb domain
CDDcd001671.02E-10411451No hitNo description
Gene3DG3DSA:1.10.10.604.3E-25411459IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0015986Biological ProcessATP synthesis coupled proton transport
GO:0003677Molecular FunctionDNA binding
GO:0046933Molecular Functionproton-transporting ATP synthase activity, rotational mechanism
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
MAFATRIRSS LPLVTKILKS DSLSAAANGS IAHRSVLCPT FINSEPSRNF STAQGKKEVK  60
VQVPLVLFGG SGNYASALYI AAVKANALEK VESEIFAIVE ATKKSPTFSQ FTKDLSVPAD  120
TRVKAIDQIA AEAKFSEITK NFLVVLAQNG RLRNLETISK RFAELTMAHK GEVKAIVTSV  180
IPLPAEEEKE LKETLQELIG QGKKVILEQK IDPSILGGLV IEFDKKVFDM SIKTRARQME  240
RYLREPEAFY IFCLIWVSVS RCGQKPIIIM EGQVQGVRVN IMDDENIDGM SNQNPSAIKR  300
KMKISIHHIN YFNQKNPKKT SPLAITMRKP ESIGKDDVDG AKTINKKKMM MSKLRKGLWS  360
PEEDEKLMXY MLTNGQGCWS DVARNAGLQR CGKSCRLRWI NYLRPDLKRG AFSPQEEELI  420
IHFHSILGNR WSQIAARLPG RTDNEIKNFW NSALKKRLKN NNMSTSTSSP NDSDSSDPRD  480
PVVGGTFMPM HDHDMMTMYN MDSSSSSSTS MQAMAVXSNT LFNPFYMLDN RYDMAHADDV  540
VVNPTCFPHL PNIGDNQGHY GDYGNLEGGH KMGLEGDLFL PPLESRSIKN NLNGQLVADN  600
ISNKNSSINN YHFHNSCFNN TELIGFKVDE EEDMFGFGNI NGGQGENVRV GEWDFEGFML  660
DTSSFLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2wss_S2e-31612455188ATP SYNTHASE SUBUNIT O, MITOCHONDRIAL
2wss_W2e-31612455188ATP SYNTHASE SUBUNIT O, MITOCHONDRIAL
5ara_S2e-31612455188ATP SYNTHASE SUBUNIT O, MITOCHONDRIAL
5are_S2e-31612455188ATP SYNTHASE SUBUNIT O, MITOCHONDRIAL
5arh_S2e-31612455188ATP SYNTHASE SUBUNIT O, MITOCHONDRIAL
5ari_S2e-31612455188ATP SYNTHASE SUBUNIT O, MITOCHONDRIAL
5fij_S2e-31612455188ATP SYNTHASE SUBUNIT O, MITOCHONDRIAL
5fik_S2e-31612455188ATP SYNTHASE SUBUNIT O, MITOCHONDRIAL
5fil_S2e-31612455188ATP SYNTHASE SUBUNIT O, MITOCHONDRIAL
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.8520.0bud| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9007084e-84JF900708.1 Pyrus pyrifolia clone PPZAAS-2 MYB gene, promoter region and 5' UTR.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008356737.10.0PREDICTED: transcription factor MYB46-like
RefseqXP_008375175.10.0PREDICTED: transcription factor MYB46-like
TrEMBLM5XMW61e-170M5XMW6_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s06630.11e-125(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.12e-67myb domain protein 46